PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009124448.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CO-like
Protein Properties Length: 408aa    MW: 45469.4 Da    PI: 7.6582
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009124448.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.54.2e-06639336
        zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg 36
                       C+ ++e  + lfC+ +   lC +C  + Hk 
  XP_009124448.1  6 RVPCDFCGERTAVLFCRADTAKLCLSCDHHVHKA 39
                    678*******9*******************9976 PP

2zf-B_box231.7e-074985337
        zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg..H 37
                     r+C+++++++++  C++++  lC++C    H +  H
  XP_009124448.1 49 SRICDNCGNEPVSVRCFTDDLVLCQECDWDVHGScsH 85
                    689************************9888844666 PP

3CCT65.51.5e-22360403144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     R +a++RYkeKrk+R+++K+irYesRKa+A++R RvKGrFvk++
  XP_009124448.1 360 RGNAMQRYKEKRKNRRYDKTIRYESRKARADTRLRVKGRFVKAT 403
                     7789**************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.556451IPR000315B-box-type zinc finger
SMARTSM003367.8E-11451IPR000315B-box-type zinc finger
CDDcd000213.30E-7751No hitNo description
PROSITE profilePS501198.5034790IPR000315B-box-type zinc finger
PfamPF006431.7E-54985IPR000315B-box-type zinc finger
CDDcd000213.32E-85080No hitNo description
SMARTSM003360.455290IPR000315B-box-type zinc finger
PfamPF062035.0E-17360402IPR010402CCT domain
PROSITE profilePS5101714.942360402IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MSSSERVPCD FCGERTAVLF CRADTAKLCL SCDHHVHKAN LLSRKHVRSR ICDNCGNEPV  60
SVRCFTDDLV LCQECDWDVH GSCSHVRSAV EGFSGCPSAL ELAALLGVDL EGRKQEKEMS  120
LMMMMTMESF GMELDSWSFG SNVLQELIVP VTDHTTTFKK RSSSCWRFKQ VLCKQLEELL  180
KGEDNDGDGG GGEAKEGIMV PVMPERLGWA RDADDSEFIH QPPTTTSFSS LISGCQSTTQ  240
IWDFNLGQSR EPEDTIRTEA AACVTKDVAS FKVNSIVKLL NDACSTKAKR VKEIFQDGYK  300
RSTSGQVPAT SENNNNLPIT FGSNTSNELC FTENTGGTSC NKATRVVAIK ADLEKLAQNR  360
GNAMQRYKEK RKNRRYDKTI RYESRKARAD TRLRVKGRFV KATEAPYP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2219851e-55AK221985.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL22-59-J18.
GenBankAY0372061e-55AY037206.1 Arabidopsis thaliana At1g28050/F13K9_15 mRNA, complete cds.
GenBankBT0026811e-55BT002681.1 Arabidopsis thaliana At1g28050/F13K9_15 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009124448.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 15-like
SwissprotQ9C7E80.0COL15_ARATH; Zinc finger protein CONSTANS-LIKE 15
TrEMBLM4FIZ80.0M4FIZ8_BRARP; Uncharacterized protein
STRINGBra041077.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38712647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28050.11e-171B-box type zinc finger protein with CCT domain